Lineage for d1qsjc_ (1qsj C:)

  1. Root: SCOPe 2.05
  2. 1715731Class a: All alpha proteins [46456] (286 folds)
  3. 1742882Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1743246Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1743519Family a.102.4.4: Complement components [48251] (4 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 1743523Protein Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg [48252] (2 species)
  7. 1743555Species Norway rat (Rattus norvegicus) [TaxId:10116] [48254] (2 PDB entries)
  8. 1743559Domain d1qsjc_: 1qsj C: [18878]
    N-terminally truncated fragment

Details for d1qsjc_

PDB Entry: 1qsj (more details), 1.9 Å

PDB Description: n-terminally truncated c3dg fragment
PDB Compounds: (C:) complement c3 precursor

SCOPe Domain Sequences for d1qsjc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsjc_ a.102.4.4 (C:) Thio-ester containing domain (TED) from Complement C3, aka C3d or C3dg {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
ppvvrwlnderyygggygstqatfmvfqalaqyrad

SCOPe Domain Coordinates for d1qsjc_:

Click to download the PDB-style file with coordinates for d1qsjc_.
(The format of our PDB-style files is described here.)

Timeline for d1qsjc_: