Lineage for d1qsjb_ (1qsj B:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1277270Family a.102.4.4: Complement components [48251] (3 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 1277271Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)
  7. 1277294Species Norway rat (Rattus norvegicus) [TaxId:10116] [48254] (2 PDB entries)
  8. 1277297Domain d1qsjb_: 1qsj B: [18877]
    N-terminally truncated fragment

Details for d1qsjb_

PDB Entry: 1qsj (more details), 1.9 Å

PDB Description: n-terminally truncated c3dg fragment
PDB Compounds: (B:) complement c3 precursor

SCOPe Domain Sequences for d1qsjb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsjb_ a.102.4.4 (B:) C3D, a C3 fragment and ligand for complement receptor 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
ppvvrwlnderyygggygstqatfmvfqalaqyrad

SCOPe Domain Coordinates for d1qsjb_:

Click to download the PDB-style file with coordinates for d1qsjb_.
(The format of our PDB-style files is described here.)

Timeline for d1qsjb_: