Lineage for d1qqfa_ (1qqf A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1276656Fold a.102: alpha/alpha toroid [48207] (6 superfamilies)
    multihelical; up to seven alpha-hairpins are arranged in closed circular array; there may be sequence similarities between different superfamilies
  4. 1276995Superfamily a.102.4: Terpenoid cyclases/Protein prenyltransferases [48239] (5 families) (S)
  5. 1277270Family a.102.4.4: Complement components [48251] (3 proteins)
    probably related to other families, but has no known enzymatic activity
  6. 1277271Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species)
  7. 1277294Species Norway rat (Rattus norvegicus) [TaxId:10116] [48254] (2 PDB entries)
  8. 1277295Domain d1qqfa_: 1qqf A: [18875]
    N-terminally truncated fragment

Details for d1qqfa_

PDB Entry: 1qqf (more details), 1.45 Å

PDB Description: n-terminally truncated c3d,g fragment of the complement system
PDB Compounds: (A:) protein (complement c3dg)

SCOPe Domain Sequences for d1qqfa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qqfa_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Norway rat (Rattus norvegicus) [TaxId: 10116]}
cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
ppvvrwlnderyygggygstqatfmvfqalaqyradv

SCOPe Domain Coordinates for d1qqfa_:

Click to download the PDB-style file with coordinates for d1qqfa_.
(The format of our PDB-style files is described here.)

Timeline for d1qqfa_: