Lineage for d1qqfa_ (1qqf A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.102: alpha/alpha toroid [48207] (4 superfamilies) Superfamily a.102.4: Terpenoid cylases/Protein prenyltransferases [48239] (4 families) 
Family a.102.4.4: C3D, a C3 fragment and ligand for complement receptor 2 [48251] (1 protein) Protein C3D, a C3 fragment and ligand for complement receptor 2 [48252] (2 species) Species Rat (Rattus norvegicus) [TaxId:10116] [48254] (2 PDB entries) 
Domain d1qqfa_: 1qqf A: [18875]
Details for d1qqfa_
PDB Entry: 1qqf (more details), 1.45 Å
PDB Description: n-terminally truncated c3d,g fragment of the complement system
SCOP Domain Sequences for d1qqfa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qqfa_ a.102.4.4 (A:) C3D, a C3 fragment and ligand for complement receptor 2 {Rat (Rattus norvegicus)}
cgeqnmigmtptviavhyldqteqwekfglekrqealelikkgytqqlafkqpisayaaf
nnrppstwltayvsrvfslaanliaidsqvlcgavkwlilekqkpdgvfqedgpvihqem
iggfrntkeadvsltafvlialqeardicegqvnslpgsinkageyleasylnlqrpytv
aiagyalalmnkleepyltkflntakdrnrweepgqqlynveatsyallallllkdfdsv
ppvvrwlnderyygggygstqatfmvfqalaqyradv
SCOP Domain Coordinates for d1qqfa_:
Click to download the PDB-style file with coordinates for d1qqfa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1qqfa_:
- d1qqfa_ appears in SCOP 1.57
- d1qqfa_ appears in the current release, SCOPe 2.08
View in 3D