SCOPe 2.04: Domain d1qo4a_: 1qo4 A:

Lineage for d1qo4a_ (1qo4 A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Plant peroxidase [48125] (6 species)

7. Species Thale cress (Arabidopsis thaliana), peroxidase A2 [TaxId:3702] [48131] (2 PDB entries)

8. Domain d1qo4a_: 1qo4 A: [18694]
   complexed with ca, hem

Details for d1qo4a_

PDB Entry: 1qo4, 3 Å

PDB Description: arabidopsis thaliana peroxidase a2 at room temperature

PDB Compounds: (A:) Peroxidase

SCOPe Domain Sequences for d1qo4a_:

Sequence; same for both SEQRES and ATOM records:

>d1qo4a_ a.93.1.1 (A:) Plant peroxidase {Thale cress (Arabidopsis thaliana), peroxidase A2 [TaxId: 3702]}
mqlnatfysgtcpnasaivrstiqqalqsdtrigaslirlhfhdcfvngcdasillddtg
siqseknagpnvnsargfnvvdniktalenacpgvvscsdvlalaseasvslaggpswtv
llgrrdsltanlaganssipspieslsnitfkfsavglntndlvalsgahtfgrarcgvf
nnrlfnfsgtgnpdptlnstllstlqqlcpqngsastitnldlstpdafdnnyfanlqsn
dgllqsdqelfsttgsstiaivtsfasnqtlffqafaqsminmgnispltgsngeirldc
kkvngs

Timeline for d1qo4a_:

• d1qo4a_ first appeared (with stable ids) in SCOP 1.55
  
• d1qo4a_ appears in SCOPe 2.03
  
• d1qo4a_ appears in SCOPe 2.05
  
• d1qo4a_ appears in the current release, SCOPe 2.08, called d1qo4a1