SCOPe 2.07: Domain d4a9kb_: 4a9k B:

Lineage for d4a9kb_ (4a9k B:)

1. Root: SCOPe 2.07

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.2: Bromodomain [47370] (2 families)

5. Family a.29.2.1: Bromodomain [47371] (6 proteins)

6. Protein automated matches [190366] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187201] (67 PDB entries)

8. Domain d4a9kb_: 4a9k B: [186741]
   automated match to d1jspb_
   complexed with edo, k, scn, tyl

Details for d4a9kb_

PDB Entry: 4a9k, 1.81 Å

PDB Description: bromodomain of human crebbp with n-(4-hydroxyphenyl)acetamide

PDB Compounds: (B:) creb-binding protein

SCOPe Domain Sequences for d4a9kb_:

Sequence; same for both SEQRES and ATOM records:

>d4a9kb_ a.29.2.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
fkpeelrqalmptlealyrqdpeslpfrqpvdpqllgipdyfdivknpmdlstikrkldt
gqyqepwqyvddvwlmfnnawlynrktsrvykfcsklaevfeqeidpvmqsl

Timeline for d4a9kb_:

• d4a9kb_ first appeared in SCOPe 2.01
  
• d4a9kb_ appears in SCOPe 2.06
  
• d4a9kb_ appears in the current release, SCOPe 2.08