Lineage for d1apxc_ (1apx C:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2333057Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 2333058Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families) (S)
  5. 2333059Family a.93.1.1: CCP-like [48114] (5 proteins)
  6. 2333060Protein Ascorbate peroxidase [48123] (3 species)
  7. 2333061Species Pea (Pisum sativum) [TaxId:3888] [48124] (1 PDB entry)
  8. 2333064Domain d1apxc_: 1apx C: [18671]
    complexed with hem, k

Details for d1apxc_

PDB Entry: 1apx (more details), 2.2 Å

PDB Description: crystal structure of recombinant ascorbate peroxidase
PDB Compounds: (C:) cytosolic ascorbate peroxidase

SCOPe Domain Sequences for d1apxc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1apxc_ a.93.1.1 (C:) Ascorbate peroxidase {Pea (Pisum sativum) [TaxId: 3888]}
gksyptvspdyqkaiekakrklrgfiaekkcaplilrlawhsagtfdsktktggpfgtik
hqaelahganngldiavrllepikeqfpivsyadfyqlagvvaveitggpevpfhpgred
kpepppegrlpdatkgsdhlrdvfgkamglsdqdivalsgghtigaahkersgfegpwts
nplifdnsyftelltgekdgllqlpsdkalltdsvfrplvekyaadedvffadyaeahlk
lselgfaea

SCOPe Domain Coordinates for d1apxc_:

Click to download the PDB-style file with coordinates for d1apxc_.
(The format of our PDB-style files is described here.)

Timeline for d1apxc_: