SCOPe 2.08: Domain d4a1wa1: 4a1w A:83-197

Lineage for d4a1wa1 (4a1w A:83-197)

1. Root: SCOPe 2.08

2. Class f: Membrane and cell surface proteins and peptides [56835] (69 folds)

3. Fold f.1: Toxins' membrane translocation domains [56836] (5 superfamilies)
   multi-helical domains of various folds which is thought to unfold in the membrane

4. Superfamily f.1.4: Bcl-2 inhibitors of programmed cell death [56854] (2 families)
   PROVISIONAL CLASSIFICATION, based on structural similarity to the diphtheria toxin domain

5. Family f.1.4.1: Bcl-2 inhibitors of programmed cell death [56855] (11 proteins)
   Pfam PF00452

6. Protein automated matches [190236] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188722] (26 PDB entries)

8. Domain d4a1wa1: 4a1w A:83-197 [186692]
   Other proteins in same PDB: d4a1wa2, d4a1wb2, d4a1wd2
   automated match to d1g5ja_

Details for d4a1wa1

PDB Entry: 4a1w, 2.5 Å

PDB Description: crystal structure of alpha-beta foldamer 4c in complex with bcl-xl

PDB Compounds: (A:) Bcl-2-like protein 1

SCOPe Domain Sequences for d4a1wa1:

Sequence; same for both SEQRES and ATOM records:

>d4a1wa1 f.1.4.1 (A:83-197) automated matches {Human (Homo sapiens) [TaxId: 9606]}
maavkqalreagdefelryrrafsdltsqlhitpgtayqsfeqvvnelfrdgvnwgriva
ffsfggalcvesvdkemqvlvsriaawmatylndhlepwiqenggwdtfvelygn

Timeline for d4a1wa1:

• d4a1wa1 first appeared in SCOPe 2.01, called d4a1wa_
  
• d4a1wa1 was called d4a1wa_ in SCOPe 2.07