SCOPe 2.04: Domain d4a0qb_: 4a0q B:

Lineage for d4a0qb_ (4a0q B:)

1. Root: SCOPe 2.04

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.62: vWA-like [53299] (1 superfamily)
   core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest

4. Superfamily c.62.1: vWA-like [53300] (6 families)

5. Family c.62.1.1: Integrin A (or I) domain [53301] (11 proteins)

6. Protein automated matches [190060] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186779] (11 PDB entries)

8. Domain d4a0qb_: 4a0q B: [186689]
   automated match to d1pt6b_
   complexed with mg; mutant

Details for d4a0qb_

PDB Entry: 4a0q, 1.9 Å

PDB Description: Activated Conformation of Integrin alpha1 I-Domain mutant

PDB Compounds: (B:) integrin alpha-1

SCOPe Domain Sequences for d4a0qb_:

Sequence; same for both SEQRES and ATOM records:

>d4a0qb_ c.62.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
qldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnkyss
teevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnhr
lkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdalalv
tivktlgerifa

Timeline for d4a0qb_:

• d4a0qb_ first appeared in SCOPe 2.01
  
• d4a0qb_ appears in SCOPe 2.03
  
• d4a0qb_ appears in SCOPe 2.05
  
• d4a0qb_ appears in the current release, SCOPe 2.08