![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.62: vWA-like [53299] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 6 strands, order 321456; strand 3 is antiparallel to the rest |
![]() | Superfamily c.62.1: vWA-like [53300] (6 families) ![]() |
![]() | Family c.62.1.1: Integrin A (or I) domain [53301] (12 proteins) |
![]() | Protein automated matches [190060] (2 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [186779] (23 PDB entries) |
![]() | Domain d4a0qb_: 4a0q B: [186689] automated match to d1pt6b_ complexed with mg; mutant |
PDB Entry: 4a0q (more details), 1.9 Å
SCOPe Domain Sequences for d4a0qb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d4a0qb_ c.62.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} qldivivldgsnsiypwdsvtaflndllermdigpkqtqvgivqygenvthefnlnkyss teevlvaakkivqrggrqtmtalgtdtarkeafteargarrgvkkvmvivtdgeshdnhr lkkviqdcedeniqrfsiailgsynrgnlstekfveeiksiaseptekhffnvsdalalv tivktlgerifa
Timeline for d4a0qb_: