Lineage for d1mn1__ (1mn1 -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) 
Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins) 
Protein Manganese peroxidase [48121] (1 species) Species Basidomycetos fungus (Phanerochaete chrysosporium) [TaxId:5306] [48122] (3 PDB entries) 
Domain d1mn1__: 1mn1 - [18667]
Details for d1mn1__
PDB Entry: 1mn1 (more details), 2 Å
PDB Description: manganese peroxidase substrate binding site mutant d179n
SCOP Domain Sequences for d1mn1__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1mn1__ a.93.1.1 (-) Manganese peroxidase {Basidomycetos fungus (Phanerochaete chrysosporium)}
avcpdgtrvshaaccafiplaqdlqetifqnecgedahevirltfhdaiaisrsqgpkag
ggadgsmllfptvepnfsanngiddsvnnlipfmqkhntisaadlvqfagavalsncpga
prleflagrpnktiaavdglipepqdsvtkilqrfedaggftpfevvsllashsvarank
vdqtidaapfdstpftfdtqvflevllkgvgfpgsanntgevasplplgsgsdtgemrlq
sdfalahdprtaciwqgfvneqafmaasfraamsklavlghnrnslidcsdvvpvpkpat
gqpamfpastgpqdlelscpserfptlttqpgasqsliahcpdgsmscpgvqfngpa
SCOP Domain Coordinates for d1mn1__:
Click to download the PDB-style file with coordinates for d1mn1__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1mn1__:
- d1mn1__ appears in SCOP 1.57
- d1mn1__ appears in the current release, SCOPe 2.08, called d1mn1a_
View in 3D