SCOPe 2.08: Domain d1aeua_: 1aeu A:

Lineage for d1aeua_ (1aeu A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries)
   Uniprot P00431

8. Domain d1aeua_: 1aeu A: [18660]
   complexed with 2mz, hem

Details for d1aeua_

PDB Entry: 1aeu, 2.1 Å

PDB Description: specificity of ligand binding in a polar cavity of cytochrome c peroxidase (2-methylimidazole)

PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1aeua_:

Sequence; same for both SEQRES and ATOM records:

>d1aeua_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

Timeline for d1aeua_:

• d1aeua_ first appeared (with stable ids) in SCOP 1.55, called d1aeu__
  
• d1aeua_ appears in SCOPe 2.07