SCOPe 2.01: Domain d3zuwm_: 3zuw M:

Lineage for d3zuwm_ (3zuw M:)

1. Root: SCOPe 2.01

2. Class f: Membrane and cell surface proteins and peptides [56835] (57 folds)

3. Fold f.26: Bacterial photosystem II reaction centre, L and M subunits [81484] (1 superfamily)
   five transmembrane helices forming a sheet-like structure

4. Superfamily f.26.1: Bacterial photosystem II reaction centre, L and M subunits [81483] (1 family)

5. Family f.26.1.1: Bacterial photosystem II reaction centre, L and M subunits [81482] (5 proteins)
   L and M are probably related to each other

6. Protein automated matches [190224] (5 species)
   not a true protein

7. Species Rhodobacter sphaeroides [TaxId:1063] [186985] (29 PDB entries)

8. Domain d3zuwm_: 3zuw M: [186596]
   automated match to d1ystm_
   complexed with bcl, bph, fe, lda, po4, spn, u10; mutant

Details for d3zuwm_

PDB Entry: 3zuw, 2.31 Å

PDB Description: photosynthetic reaction centre mutant with tyr l128 replaced with his

PDB Compounds: (M:) reaction center protein m chain

SCOPe Domain Sequences for d3zuwm_:

Sequence; same for both SEQRES and ATOM records:

>d3zuwm_ f.26.1.1 (M:) automated matches {Rhodobacter sphaeroides [TaxId: 1063]}
aeyqnifsqvqvrgpadlgmtedvnlanrsgvgpfstllgwfgnaqlgpiylgslgvlsl
fsglmwfftigiwfwyqagwnpavflrdlfffsleppapeyglsfaaplkegglwliasf
fmfvavwswwgrtylraqalgmgkhtawaflsaiwlwmvlgfirpilmgswseavpygif
shldwtnnfslvhgnlfynpfhglsiaflygsallfamhgatilavsrfggereleqiad
rgtaaeraalfwrwtmgfnatmegihrwaiwmavlvtltggigillsgtvvdnwyvwgqn
hg

Timeline for d3zuwm_:

• d3zuwm_ is new in SCOPe 2.01-stable
  
• d3zuwm_ appears in SCOPe 2.02
  
• d3zuwm_ appears in the current release, SCOPe 2.08