Lineage for d3ztxb_ (3ztx B:)

  1. Root: SCOPe 2.02
  2. 1190016Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1220003Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 1220004Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 1220070Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 1221476Protein automated matches [190091] (10 species)
    not a true protein
  7. 1221477Species African clawed frog (Xenopus laevis) [TaxId:8355] [187456] (6 PDB entries)
  8. 1221489Domain d3ztxb_: 3ztx B: [186571]
    automated match to d1ol5a_
    complexed with ztx

Details for d3ztxb_

PDB Entry: 3ztx (more details), 1.95 Å

PDB Description: Aurora kinase selective inhibitors identified using a Taxol-induced checkpoint sensitivity screen.
PDB Compounds: (B:) serine/threonine-protein kinase 12-a

SCOPe Domain Sequences for d3ztxb_:

Sequence, based on SEQRES records: (download)

>d3ztxb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
talaempkrkftiddfdigrplgkgkfgnvylarekqnkfimalkvlfksqlekegvehq
lrreieiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfm
eeladalhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylp
pemiegkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgsk
dliskllryhppqrlplkgvmehpwvkansrrvlppvy

Sequence, based on observed residues (ATOM records): (download)

>d3ztxb_ d.144.1.7 (B:) automated matches {African clawed frog (Xenopus laevis) [TaxId: 8355]}
talaempkrkftiddfdigrplgnvylarekqnkfimalkvlfksqlekegvehqlrrei
eiqshlrhpnilrmynyfhdrkriylmlefaprgelykelqkhgrfdeqrsatfmeelad
alhycherkvihrdikpenllmgykgelkiadfgwsvhapslrrrtmcgtldylppemie
gkthdekvdlwcagvlcyeflvgmppfdspshtethrrivnvdlkfppflsdgskdlisk
llryhppqrlplkgvmehpwvkansrrvlppvy

SCOPe Domain Coordinates for d3ztxb_:

Click to download the PDB-style file with coordinates for d3ztxb_.
(The format of our PDB-style files is described here.)

Timeline for d3ztxb_: