SCOPe 2.02: Domain d1ac4a_: 1ac4 A:

Lineage for d1ac4a_ (1ac4 A:)

1. Root: SCOPe 2.02

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (145 PDB entries)
   Uniprot P00431

8. Domain d1ac4a_: 1ac4 A: [18657]
   complexed with hem, tmt

Details for d1ac4a_

PDB Entry: 1ac4, 2.1 Å

PDB Description: variation in the strength of a ch to o hydrogen bond in an artificial protein cavity (2,3,4-trimethyl-1,3-thiazole)

PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1ac4a_:

Sequence; same for both SEQRES and ATOM records:

>d1ac4a_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

Timeline for d1ac4a_:

• d1ac4a_ first appeared (with stable ids) in SCOP 1.55, called d1ac4__
  
• d1ac4a_ appears in SCOPe 2.01
  
• d1ac4a_ appears in SCOPe 2.03
  
• d1ac4a_ appears in the current release, SCOPe 2.08