SCOPe 2.03: Domain d3zrmb_: 3zrm B:

Lineage for d3zrmb_ (3zrm B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Glycogen synthase kinase-3 beta (Gsk3b) [69823] (1 species)
   CMGC group; GSK3 subfamily; serine/threonine kinase

7. Species Human (Homo sapiens) [TaxId:9606] [69824] (30 PDB entries)
   Uniprot P49841 35-383 ! Uniprot P49841 35-384

8. Domain d3zrmb_: 3zrm B: [186538]
   automated match to d1j1bb_
   complexed with gol, so4, zrm

Details for d3zrmb_

PDB Entry: 3zrm, 2.49 Å

PDB Description: Identification of 2-(4-pyridyl)thienopyridinones as GSK-3beta inhibitors

PDB Compounds: (B:) Glycogen synthase kinase-3 beta

SCOPe Domain Sequences for d3zrmb_:

Sequence; same for both SEQRES and ATOM records:

>d3zrmb_ d.144.1.7 (B:) Glycogen synthase kinase-3 beta (Gsk3b) {Human (Homo sapiens) [TaxId: 9606]}
kvttvvatpgqgpdrpqevsytdtkvigngsfgvvyqaklcdsgelvaikkvlqdkrfkn
relqimrkldhcnivrlryffyssgekkdevylnlvldyvpetvyrvarhysrakqtlpv
iyvklymyqlfrslayihsfgichrdikpqnllldpdtavlklcdfgsakqlvrgepnvs
yicsryyrapelifgatdytssidvwsagcvlaelllgqpifpgdsgvdqlveiikvlgt
ptreqiremnpnytefkfpqikahpwtkvfrprtppeaialcsrlleytptarltpleac
ahsffdelrdpnvklpngrdtpalfnfttqelssnpplatilipphari

Timeline for d3zrmb_:

• d3zrmb_ first appeared in SCOPe 2.01
  
• d3zrmb_ appears in SCOPe 2.02
  
• d3zrmb_ appears in SCOPe 2.04
  
• d3zrmb_ appears in the current release, SCOPe 2.08