Lineage for d3zrbb_ (3zrb B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 923257Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 923258Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 923259Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 923994Protein automated matches [190059] (10 species)
    not a true protein
  7. 924007Species Human (Homo sapiens) [TaxId:9606] [187214] (97 PDB entries)
  8. 924022Domain d3zrbb_: 3zrb B: [186532]
    automated match to d1a28a_
    complexed with gol, or8, orc, so4

Details for d3zrbb_

PDB Entry: 3zrb (more details), 1.8 Å

PDB Description: structural basis for agonism and antagonism for a set of chemically related progesterone receptor modulators
PDB Compounds: (B:) progesterone receptor

SCOPe Domain Sequences for d3zrbb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zrbb_ a.123.1.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfhk

SCOPe Domain Coordinates for d3zrbb_:

Click to download the PDB-style file with coordinates for d3zrbb_.
(The format of our PDB-style files is described here.)

Timeline for d3zrbb_: