Lineage for d3zrba_ (3zrb A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2011944Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
    multihelical; 3 layers or orthogonally packed helices
  4. 2011945Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) (S)
  5. 2011946Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)
  6. 2012913Protein automated matches [190059] (14 species)
    not a true protein
  7. 2012935Species Human (Homo sapiens) [TaxId:9606] [187214] (173 PDB entries)
  8. 2012951Domain d3zrba_: 3zrb A: [186531]
    automated match to d1a28a_
    complexed with gol, or8, orc, so4

Details for d3zrba_

PDB Entry: 3zrb (more details), 1.8 Å

PDB Description: structural basis for agonism and antagonism for a set of chemically related progesterone receptor modulators
PDB Compounds: (A:) progesterone receptor

SCOPe Domain Sequences for d3zrba_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3zrba_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfhk

SCOPe Domain Coordinates for d3zrba_:

Click to download the PDB-style file with coordinates for d3zrba_.
(The format of our PDB-style files is described here.)

Timeline for d3zrba_: