SCOPe 2.08: Domain d3zraa_: 3zra A:

Lineage for d3zraa_ (3zra A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily)
   multihelical; 3 layers or orthogonally packed helices

4. Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families)

5. Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins)

6. Protein automated matches [190059] (14 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187214] (171 PDB entries)

8. Domain d3zraa_: 3zra A: [186529]
   automated match to d1a28a_
   complexed with orb, so4

Details for d3zraa_

PDB Entry: 3zra, 1.9 Å

PDB Description: structural basis for agonism and antagonism for a set of chemically related progesterone receptor modulators

PDB Compounds: (A:) progesterone receptor

SCOPe Domain Sequences for d3zraa_:

Sequence; same for both SEQRES and ATOM records:

>d3zraa_ a.123.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lipplinllmsiepdviyaghdntkpdtssslltslnqlgerqllsvvkwskslpgfrnl
hiddqitliqyswmslmvfglgwrsykhvsgqmlyfapdlilneqrmkessfyslcltmw
qipqefvklqvsqeeflcmkvllllntipleglrsqtqfeemrssyirelikaiglrqkg
vvsssqrfyqltklldnlhdlvkqlhlyclntfiqsralsvefpemmseviaaqlpkila
gmvkpllfhk

Timeline for d3zraa_:

• d3zraa_ first appeared in SCOPe 2.01
  
• d3zraa_ appears in SCOPe 2.07