Class a: All alpha proteins [46456] (289 folds) |
Fold a.123: Nuclear receptor ligand-binding domain [48507] (1 superfamily) multihelical; 3 layers or orthogonally packed helices |
Superfamily a.123.1: Nuclear receptor ligand-binding domain [48508] (2 families) |
Family a.123.1.1: Nuclear receptor ligand-binding domain [48509] (34 proteins) |
Protein automated matches [190059] (14 species) not a true protein |
Species Escherichia coli [TaxId:469008] [189841] (1 PDB entry) |
Domain d3zqta_: 3zqt A: [186517] automated match to d1e3ga_ complexed with 30z, so4, tes |
PDB Entry: 3zqt (more details), 2.29 Å
SCOPe Domain Sequences for d3zqta_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3zqta_ a.123.1.1 (A:) automated matches {Escherichia coli [TaxId: 469008]} qpiflnvleaiepgvvcaghdnnqpdsfaallsslnelgerqlvhvvkwakalpgfrnlh vddqmaviqyswmglmvfamgwrsftnvnsrmlyfapdlvfneyrmhksrmysqcvrmrh lsqefgwlqitpqeflcmkalllfsiipvdglknqkffdelrmnyikeldriiackrknp tscsrrfyqltklldsvqpiarelhqftfdllikshmvsvdfpemmaeiisvqvpkilsg kvkpiyfhtq
Timeline for d3zqta_: