Lineage for d3vlva_ (3vlv A:)

  1. Root: SCOPe 2.02
  2. 1143363Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1185373Fold c.94: Periplasmic binding protein-like II [53849] (1 superfamily)
    consists of two similar intertwined domain with 3 layers (a/b/a) each: duplication
    mixed beta-sheet of 5 strands, order 21354; strand 5 is antiparallel to the rest
  4. 1185374Superfamily c.94.1: Periplasmic binding protein-like II [53850] (4 families) (S)
    Similar in architecture to the superfamily I but partly differs in topology
  5. 1185375Family c.94.1.1: Phosphate binding protein-like [53851] (41 proteins)
  6. 1186093Protein automated matches [190140] (9 species)
    not a true protein
  7. 1186185Species Sphingomonas sp. [TaxId:90322] [186866] (5 PDB entries)
  8. 1186186Domain d3vlva_: 3vlv A: [186514]
    automated match to d1j1na_
    complexed with ca

Details for d3vlva_

PDB Entry: 3vlv (more details), 1.5 Å

PDB Description: crystal structure of sphingomonas sp. a1 alginate-binding ptotein algq1 in complex with unsaturated triguluronate
PDB Compounds: (A:) AlgQ1

SCOPe Domain Sequences for d3vlva_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3vlva_ c.94.1.1 (A:) automated matches {Sphingomonas sp. [TaxId: 90322]}
reatwvtekpltlkihmhfrdkwvwdenwpvarevarltnvklvgvanraatnsqeqfnl
mmasgqlpdivggdnlkdkfirygmegafiplnklidqnapnlkaffkthpevqraitap
dgniyylpyvpdglvsrgyfirqdwldklhlktpqtvdelytvlkafkekdpngngkade
ipfinrdpeevfrlvnfwgarstgsntwmdfyvengkikhpfaevafkdgikhvaqwyke
glidpeiftrkarsreqtfgnniggmthdwfastalfndalsknipgfklvpmappinsk
gqrweedarqiprpdgwaitatnknpvetiklfdfyfgpkgrelsnfgvpgltydikngk
pvykdtvlkaaqpvnnqmydigaqipigfwqdyeyerqwtndvalqgidmyiknkyvlpq
ftgvnltveereiydkywpdvktymfemgqswvmgtkdpektwndyqqqlknrgfyqvmi
vmqkaydrqy

SCOPe Domain Coordinates for d3vlva_:

Click to download the PDB-style file with coordinates for d3vlva_.
(The format of our PDB-style files is described here.)

Timeline for d3vlva_: