Lineage for d1aeh__ (1aeh -)

  1. Root: SCOP 1.67
  2. 349259Class a: All alpha proteins [46456] (202 folds)
  3. 358328Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
    multihelical; consists of two all-alpha domains
  4. 358329Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families) (S)
  5. 358330Family a.93.1.1: CCP-like [48114] (4 proteins)
  6. 358342Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 358343Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (81 PDB entries)
  8. 358407Domain d1aeh__: 1aeh - [18651]
    complexed with 24t, hem; mutant

Details for d1aeh__

PDB Entry: 1aeh (more details), 2.1 Å

PDB Description: specificity of ligand binding to a buried polar cavity at the active site of cytochrome c peroxidase (2-amino-4-methylthiazole)

SCOP Domain Sequences for d1aeh__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1aeh__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d1aeh__:

Click to download the PDB-style file with coordinates for d1aeh__.
(The format of our PDB-style files is described here.)

Timeline for d1aeh__: