SCOP 1.75: Domain d1aega_: 1aeg A:

Lineage for d1aega_ (1aeg A:)

1. Root: SCOP 1.75

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (123 PDB entries)
   Uniprot P00431

8. Domain d1aega_: 1aeg A: [18650]
   complexed with 4ap, hem; mutant

Details for d1aega_

PDB Entry: 1aeg, 2.1 Å

PDB Description: specificity of ligand binding to a buried polar cavity at the active site of cytochrome c peroxidase (4-aminopyridine)

PDB Compounds: (A:) cytochrome c peroxidase

SCOP Domain Sequences for d1aega_:

Sequence; same for both SEQRES and ATOM records:

>d1aega_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

Timeline for d1aega_:

• d1aega_ first appeared (with stable ids) in SCOP 1.55, called d1aeg__
  
• d1aega_ appears in SCOP 1.73
  
• d1aega_ appears in SCOPe 2.01
  
• d1aega_ appears in the current release, SCOPe 2.08