SCOP 1.67: Domain d1ac8__: 1ac8 -

Lineage for d1ac8__ (1ac8 -)

1. Root: SCOP 1.67

2. Class a: All alpha proteins [46456] (202 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (81 PDB entries)

8. Domain d1ac8__: 1ac8 - [18645]
   complexed with hem, tmz; mutant

Details for d1ac8__

PDB Entry: 1ac8, 2.1 Å

PDB Description: variation in the strength of a ch to o hydrogen bond in an artificial protein cavity (3,4,5-trimethylthiazole)

SCOP Domain Sequences for d1ac8__:

Sequence; same for both SEQRES and ATOM records:

>d1ac8__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

Timeline for d1ac8__:

• d1ac8__ first appeared (with stable ids) in SCOP 1.55
  
• d1ac8__ appears in SCOP 1.65
  
• d1ac8__ appears in SCOP 1.69
  
• d1ac8__ appears in the current release, SCOPe 2.08, called d1ac8a_