SCOPe 2.05: Domain d3uyoa_: 3uyo A:

Lineage for d3uyoa_ (3uyo A:)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.93: SH2-like [55549] (1 superfamily)
   3 layers: a/b/a; antiparallel beta-sheet of 5 strands is flanked by two helices

4. Superfamily d.93.1: SH2 domain [55550] (2 families)

5. Family d.93.1.1: SH2 domain [55551] (35 proteins)
   Pfam PF00017

6. Protein automated matches [190202] (2 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186949] (13 PDB entries)

8. Domain d3uyoa_: 3uyo A: [186434]
   Other proteins in same PDB: d3uyod_
   automated match to d1ab2a_
   complexed with so4

Details for d3uyoa_

PDB Entry: 3uyo, 1.83 Å

PDB Description: Crystal structure of monobody SH13/ABL1 SH2 domain complex

PDB Compounds: (A:) Tyrosine-protein kinase ABL1

SCOPe Domain Sequences for d3uyoa_:

Sequence; same for both SEQRES and ATOM records:

>d3uyoa_ d.93.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
yitpvnslekhswyhgpvsrnaaeyllssgingsflvresesspgqrsislryegrvyhy
rintasdgklyvssesrfntlaelvhhhstvadglittlhypapkrnkptvygv

Timeline for d3uyoa_:

• d3uyoa_ first appeared in SCOPe 2.01
  
• d3uyoa_ appears in SCOPe 2.04
  
• d3uyoa_ appears in SCOPe 2.06
  
• d3uyoa_ appears in the current release, SCOPe 2.08