Lineage for d3uyna_ (3uyn A:)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 961516Fold b.74: Carbonic anhydrase [51068] (1 superfamily)
    single sheet; 10 strands
  4. 961517Superfamily b.74.1: Carbonic anhydrase [51069] (2 families) (S)
  5. 961518Family b.74.1.1: Carbonic anhydrase [51070] (2 proteins)
  6. 961969Protein automated matches [190681] (1 species)
    not a true protein
  7. 961970Species Human (Homo sapiens) [TaxId:9606] [187805] (10 PDB entries)
  8. 961982Domain d3uyna_: 3uyn A: [186433]
    automated match to d1flja_
    complexed with zn

Details for d3uyna_

PDB Entry: 3uyn (more details), 2.6 Å

PDB Description: hca 3
PDB Compounds: (A:) Carbonic anhydrase 3

SCOPe Domain Sequences for d3uyna_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3uyna_ b.74.1.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
akewgyashngpdhwhelfpnakgenqspielhtkdirhdpslqpwsvsydggsaktiln
ngktchvvfddtydrsmlrggplpgpyrlrqfhlhwgssddhgsehtvdgvkyaaelhlv
hwnpkyntfkealkqrdgiavigiflkighengefqifldaldkiktkgkeapftkfdps
slfpasrdywtyqgsfttppceecivwlllkepmtvssdqmaklrsllssaeneppvplv
snwrppqpinnrvvrasfk

SCOPe Domain Coordinates for d3uyna_:

Click to download the PDB-style file with coordinates for d3uyna_.
(The format of our PDB-style files is described here.)

Timeline for d3uyna_: