SCOPe 2.03: Domain d3uvea_: 3uve A:

Lineage for d3uvea_ (3uve A:)

1. Root: SCOPe 2.03

2. Class c: Alpha and beta proteins (a/b) [51349] (147 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (159 species)
   not a true protein

7. Species Mycobacterium avium [TaxId:243243] [189589] (4 PDB entries)

8. Domain d3uvea_: 3uve A: [186416]
   automated match to d1iy8a_
   complexed with edo, nad, pg4

Details for d3uvea_

PDB Entry: 3uve, 1.55 Å

PDB Description: crystal structure of carveol dehydrogenase ((+)-trans-carveol dehydrogenase) from mycobacterium avium

PDB Compounds: (A:) Carveol dehydrogenase ((+)-trans-carveol dehydrogenase)

SCOPe Domain Sequences for d3uvea_:

Sequence; same for both SEQRES and ATOM records:

>d3uvea_ c.2.1.0 (A:) automated matches {Mycobacterium avium [TaxId: 243243]}
tgrvegkvafvtgaargqgrshavrlaqegadiiavdickpiragvvdtaipastpedla
etadlvkghnrrivtaevdvrdydalkaavdsgveqlgrldiivanagignggdtldkts
eedwtemidinlagvwktvkagvphmiaggrggsiiltssvgglkayphtghyvaakhgv
vglmrafgvelgqhmirvnsvhpthvktpmlhnegtfkmfrpdlenpgpddmapicqmfh
tlpipwvepidisnavlffasdearyitgvtlpidagsclk

Timeline for d3uvea_:

• d3uvea_ first appeared in SCOPe 2.01
  
• d3uvea_ appears in SCOPe 2.02
  
• d3uvea_ appears in SCOPe 2.04
  
• d3uvea_ appears in the current release, SCOPe 2.08