SCOPe 2.04: Domain d1cyfa_: 1cyf A:

Lineage for d1cyfa_ (1cyf A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (170 PDB entries)
   Uniprot P00431

8. Domain d1cyfa_: 1cyf A: [18641]
   complexed with hem

Details for d1cyfa_

PDB Entry: 1cyf, 2.35 Å

PDB Description: identifying the physiological electron transfer site of cytochrome c peroxidase by structure-based engineering

PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1cyfa_:

Sequence; same for both SEQRES and ATOM records:

>d1cyfa_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
mittplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwd
khdntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqe
mqgpkipwragrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalg
kthlknsgyegpwgcannvftnefylnllnedwklekndanneqwdsksgymmlptdysl
iqdpkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d1cyfa_:

• d1cyfa_ first appeared (with stable ids) in SCOP 1.55, called d1cyf__
  
• d1cyfa_ appears in SCOPe 2.03
  
• d1cyfa_ appears in SCOPe 2.05
  
• d1cyfa_ appears in the current release, SCOPe 2.08