Lineage for d1cmq__ (1cmq -)

  1. Root: SCOP 1.55
  2. 2Class a: All alpha proteins [46456] (138 folds)
  3. 5254Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
  4. 5255Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) (S)
  5. 5256Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins)
  6. 5263Protein Cytochrome c peroxidase, CCP [48119] (1 species)
  7. 5264Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (64 PDB entries)
  8. 5305Domain d1cmq__: 1cmq - [18639]

Details for d1cmq__

PDB Entry: 1cmq (more details), 2.3 Å

PDB Description: small molecule binding to an artificially created cavity at the active site of cytochrome c peroxidase

SCOP Domain Sequences for d1cmq__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1cmq__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpggaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

SCOP Domain Coordinates for d1cmq__:

Click to download the PDB-style file with coordinates for d1cmq__.
(The format of our PDB-style files is described here.)

Timeline for d1cmq__: