SCOPe 2.04: Domain d3uoha_: 3uoh A:

Lineage for d3uoha_ (3uoh A:)

1. Root: SCOPe 2.04

2. Class d: Alpha and beta proteins (a+b) [53931] (380 folds)

3. Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
   consists of two alpha+beta domains, C-terminal domain is mostly alpha helical

4. Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families)
   shares functional and structural similarities with the ATP-grasp fold and PIPK

5. Family d.144.1.7: Protein kinases, catalytic subunit [88854] (64 proteins)
   members organized in the groups and subfamiles specified by the comments

6. Protein Aurora-related kinase 1 (aurora-2) [90038] (1 species)
   OPK group; AIRK subfamily; serine/threonine kinase
7. Species Human (Homo sapiens) [TaxId:9606] [90039] (43 PDB entries)

8. Domain d3uoha_: 3uoh A: [186360]
   automated match to d1ol5a_
   complexed with 0c4, edo

Details for d3uoha_

PDB Entry: 3uoh, 2.8 Å

PDB Description: Aurora A in complex with RPM1722

PDB Compounds: (A:) Aurora kinase A

SCOPe Domain Sequences for d3uoha_:

Sequence; same for both SEQRES and ATOM records:

>d3uoha_ d.144.1.7 (A:) Aurora-related kinase 1 (aurora-2) {Human (Homo sapiens) [TaxId: 9606]}
rqwaledfeigrplgkgkfgnvylarekqskfilalkvlfkaqlekagvehqlrreveiq
shlrhpnilrlygyfhdatrvylileyaplgtvyrelqklskfdeqrtatyitelanals
ychskrvihrdikpenlllgsagelkiadfgwsvhapssrrdtlcgtldylppemiegrm
hdekvdlwslgvlcyeflvgkppfeantyqetykrisrveftfpdfvtegardlisrllk
hnpsqrpmlrevlehpwitanssk

Timeline for d3uoha_:

• d3uoha_ first appeared in SCOPe 2.01
  
• d3uoha_ appears in SCOPe 2.03
  
• d3uoha_ appears in SCOPe 2.05
  
• d3uoha_ appears in the current release, SCOPe 2.08