SCOPe 2.03: Domain d3uidb_: 3uid B:

Lineage for d3uidb_ (3uid B:)

1. Root: SCOPe 2.03

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (13 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [189822] (1 PDB entry)

8. Domain d3uidb_: 3uid B: [186317]
   automated match to d1xfsa_

Details for d3uidb_

PDB Entry: 3uid, 1.57 Å

PDB Description: crystal structure of protein ms6760 from mycobacterium smegmatis

PDB Compounds: (B:) Putative uncharacterized protein

SCOPe Domain Sequences for d3uidb_:

Sequence, based on SEQRES records:

>d3uidb_ d.129.3.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
pvtdvkhdldtltltitaefaapvtriwqiyadprqlekvwgppshpatvvdhdlrpggr
vtyfmtgpdgekyagyweitavdephsfsfldgfadedfnpntdlpvstnvytftehdgg
tratyvgtyasaealqqvldmgviegassainqidalltath

Sequence, based on observed residues (ATOM records):

>d3uidb_ d.129.3.0 (B:) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
pvtdvkhdldtltltitaefaapvtriwqiyadprqlekvwgppshpatvvdhdlrpggr
vtyfmtgpdgekyagyweitavdephsfsfldgfadedfnpvstnvytftehdggtraty
vgtyasaealqqvldmgviegassainqidalltath

Timeline for d3uidb_:

• d3uidb_ first appeared in SCOPe 2.01
  
• d3uidb_ appears in SCOPe 2.02
  
• d3uidb_ appears in SCOPe 2.04
  
• d3uidb_ appears in the current release, SCOPe 2.08, called d3uidb1