SCOPe 2.08: Domain d3uida1: 3uid A:2-161

Lineage for d3uida1 (3uid A:2-161)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.129: TBP-like [55944] (11 superfamilies)
   beta-alpha-beta(4)-alpha

4. Superfamily d.129.3: Bet v1-like [55961] (11 families)
   contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix

5. Family d.129.3.0: automated matches [191339] (1 protein)
   not a true family

6. Protein automated matches [190218] (21 species)
   not a true protein

7. Species Mycobacterium smegmatis [TaxId:246196] [189822] (1 PDB entry)

8. Domain d3uida1: 3uid A:2-161 [186316]
   Other proteins in same PDB: d3uida2, d3uidb2
   automated match to d1xfsa_

Details for d3uida1

PDB Entry: 3uid, 1.57 Å

PDB Description: crystal structure of protein ms6760 from mycobacterium smegmatis

PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3uida1:

Sequence; same for both SEQRES and ATOM records:

>d3uida1 d.129.3.0 (A:2-161) automated matches {Mycobacterium smegmatis [TaxId: 246196]}
pvtdvkhdldtltltitaefaapvtriwqiyadprqlekvwgppshpatvvdhdlrpggr
vtyfmtgpdgekyagyweitavdephsfsfldgfadedfnpntdlpvstnvytftehdgg
tratyvgtyasaealqqvldmgviegassainqidallta

Timeline for d3uida1:

• d3uida1 first appeared in SCOPe 2.01, called d3uida_
  
• d3uida1 appears in SCOPe 2.07