Lineage for d3ui0b_ (3ui0 B:)

  1. Root: SCOPe 2.01
  2. 901761Class a: All alpha proteins [46456] (284 folds)
  3. 901762Fold a.1: Globin-like [46457] (2 superfamilies)
    core: 6 helices; folded leaf, partly opened
  4. 901763Superfamily a.1.1: Globin-like [46458] (5 families) (S)
  5. 901830Family a.1.1.2: Globins [46463] (27 proteins)
    Heme-binding protein
  6. 903555Protein automated matches [190359] (30 species)
    not a true protein
  7. 903559Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (30 PDB entries)
  8. 903583Domain d3ui0b_: 3ui0 B: [186313]
    automated match to d1nxfa_
    complexed with hem

Details for d3ui0b_

PDB Entry: 3ui0 (more details), 1.8 Å

PDB Description: hbi (t72g) deoxy
PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d3ui0b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3ui0b_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsiglmyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

SCOPe Domain Coordinates for d3ui0b_:

Click to download the PDB-style file with coordinates for d3ui0b_.
(The format of our PDB-style files is described here.)

Timeline for d3ui0b_: