Lineage for d1ccb__ (1ccb -)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) 
Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins) 
Protein Cytochrome c peroxidase, CCP [48119] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (64 PDB entries) 
Domain d1ccb__: 1ccb - [18631]
Details for d1ccb__
PDB Entry: 1ccb (more details), 2.1 Å
PDB Description: the asp-his-fe triad of cytochrome c peroxidase controls the reduction potential, electronic structure, and coupling of the tryptophan free- radical to the heme
SCOP Domain Sequences for d1ccb__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ccb__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlpteysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
SCOP Domain Coordinates for d1ccb__:
Click to download the PDB-style file with coordinates for d1ccb__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ccb__:
- d1ccb__ appears in SCOP 1.57
- d1ccb__ appears in the current release, SCOPe 2.08, called d1ccba_
View in 3D