SCOPe 2.01: Domain d3uhvb_: 3uhv B:

Lineage for d3uhvb_ (3uhv B:)

1. Root: SCOPe 2.01

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (30 species)
   not a true protein

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (30 PDB entries)

8. Domain d3uhvb_: 3uhv B: [186303]
   automated match to d1nxfa_
   complexed with hem

Details for d3uhvb_

PDB Entry: 3uhv, 1.75 Å

PDB Description: hbi (m37v,l73i) deoxy

PDB Compounds: (B:) Globin-1

SCOPe Domain Sequences for d3uhvb_:

Sequence; same for both SEQRES and ATOM records:

>d3uhvb_ a.1.1.2 (B:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalvttlfadnqetigyfkrlgdvsqgm
andklrghsitimyalqnfidqldnpddlvcvvekfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d3uhvb_:

• d3uhvb_ is new in SCOPe 2.01-stable
  
• d3uhvb_ appears in SCOPe 2.02
  
• d3uhvb_ appears in the current release, SCOPe 2.08