SCOPe 2.04: Domain d1beqa_: 1beq A:

Lineage for d1beqa_ (1beq A:)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (170 PDB entries)
   Uniprot P00431

8. Domain d1beqa_: 1beq A: [18629]
   complexed with hem, mes

Details for d1beqa_

PDB Entry: 1beq, 2.16 Å

PDB Description: interaction between proximal and distals regions of cytochrome c peroxidase

PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1beqa_:

Sequence; same for both SEQRES and ATOM records:

>d1beqa_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpygaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafeklledgitfpkdapspfifktleeqgl

Timeline for d1beqa_:

• d1beqa_ first appeared (with stable ids) in SCOP 1.55, called d1beq__
  
• d1beqa_ appears in SCOPe 2.03
  
• d1beqa_ appears in SCOPe 2.05
  
• d1beqa_ appears in the current release, SCOPe 2.08