SCOPe 2.06: Domain d3uhkc_: 3uhk C:

Lineage for d3uhkc_ (3uhk C:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.1: Globin-like [46457] (2 superfamilies)
   core: 6 helices; folded leaf, partly opened

4. Superfamily a.1.1: Globin-like [46458] (5 families)

5. Family a.1.1.2: Globins [46463] (27 proteins)
   Heme-binding protein

6. Protein automated matches [190359] (42 species)
   not a true protein

7. Species Ark clam (Scapharca inaequivalvis) [TaxId:6561] [187427] (32 PDB entries)

8. Domain d3uhkc_: 3uhk C: [186288]
   automated match to d1nxfa_
   complexed with hem

Details for d3uhkc_

PDB Entry: 3uhk, 2 Å

PDB Description: hbi (k96r) without ligand bound

PDB Compounds: (C:) Globin-1

SCOPe Domain Sequences for d3uhkc_:

Sequence; same for both SEQRES and ATOM records:

>d3uhkc_ a.1.1.2 (C:) automated matches {Ark clam (Scapharca inaequivalvis) [TaxId: 6561]}
svydaaaqltadvkkdlrdswkvigsdkkgngvalmttlfadnqetigyfkrlgdvsqgm
andklrghsitlmyalqnfidqldnpddlvcvverfavnhitrkisaaefgkingpikkv
lasknfgdkyanawaklvavvqaal

Timeline for d3uhkc_:

• d3uhkc_ first appeared in SCOPe 2.01
  
• d3uhkc_ appears in SCOPe 2.05
  
• d3uhkc_ appears in SCOPe 2.07
  
• d3uhkc_ appears in the current release, SCOPe 2.08