SCOPe 2.08: Domain d4ccpa_: 4ccp A:

Lineage for d4ccpa_ (4ccp A:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (206 PDB entries)
   Uniprot P00431

8. Domain d4ccpa_: 4ccp A: [18626]
   complexed with hem; mutant

Details for d4ccpa_

PDB Entry: 4ccp, 2.2 Å

PDB Description: x-ray structures of recombinant yeast cytochrome c peroxidase and three heme-cleft mutants prepared by site-directed mutagenesis

PDB Compounds: (A:) yeast cytochrome c peroxidase

SCOPe Domain Sequences for d4ccpa_:

Sequence; same for both SEQRES and ATOM records:

>d4ccpa_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlafhisgtwdkhd
ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
pkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkth
lknsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d4ccpa_:

• d4ccpa_ first appeared (with stable ids) in SCOP 1.55, called d4ccp__
  
• d4ccpa_ appears in SCOPe 2.07