Lineage for d3udla_ (3udl A:)

  1. Root: SCOPe 2.07
  2. 2568173Class e: Multi-domain proteins (alpha and beta) [56572] (71 folds)
  3. 2571153Fold e.8: DNA/RNA polymerases [56671] (1 superfamily)
    divided into morphological domains including "palm", "thumb" and "fingers"; the catalytic "palm" domain is conserved to all members
  4. 2571154Superfamily e.8.1: DNA/RNA polymerases [56672] (8 families) (S)
    "palm" domain has a ferredoxin-like fold, related to that of an adenylyl cyclase domain
  5. 2572036Family e.8.1.4: RNA-dependent RNA-polymerase [56694] (3 proteins)
  6. 2572350Protein automated matches [190260] (24 species)
    not a true protein
  7. 2572444Species Hepatitis C virus subtype 1b [TaxId:31647] [187148] (4 PDB entries)
  8. 2572449Domain d3udla_: 3udl A: [186234]
    automated match to d1nb4a_
    complexed with kli

Details for d3udla_

PDB Entry: 3udl (more details), 2.17 Å

PDB Description: 3-heterocyclyl quinolone bound to HCV NS5B
PDB Compounds: (A:) hcv ns5b polymerase

SCOPe Domain Sequences for d3udla_:

Sequence, based on SEQRES records: (download)

>d3udla_ e.8.1.4 (A:) automated matches {Hepatitis C virus subtype 1b [TaxId: 31647]}
smsytwtgalitpcaaeesklpinalsnsllrhhnmvyattsrsaglrqkkvtfdrlqvl
ddhyrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhih
svwkdlledtvtpidttimaknevfcvqpekggrkparlivfpdlgvrvcekmalydvvs
tlpqvvmgssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiy
qccdlapearqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkas
aacraaklqdctmlvngddlvvicesagtqedaaslrvfteamtrysappgdppqpeydl
elitscssnvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlw
armilmthffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspg
einrvasclrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktklkltpip
aasqldlsgwfvagysggdiyhs

Sequence, based on observed residues (ATOM records): (download)

>d3udla_ e.8.1.4 (A:) automated matches {Hepatitis C virus subtype 1b [TaxId: 31647]}
smsytwtgalitpcaaeesklplsnsllrhhnmvyattsrsaglrqkkvtfdrlqvlddh
yrdvlkemkakastvkakllsveeackltpphsakskfgygakdvrnlsskavnhihsvw
kdlledtvtpidttimaknevfcvqrkparlivfpdlgvrvcekmalydvvstlpqvvmg
ssygfqyspgqrveflvntwkskknpmgfsydtrcfdstvtendirveesiyqccdlape
arqaikslterlyiggpltnskgqncgyrrcrasgvlttscgntltcylkasaacraakl
qdctmlvngddlvvicesagtqedaaslrvfteamtrysappgdppqpeydlelitscss
nvsvahdasgkrvyyltrdpttplaraawetarhtpvnswlgniimyaptlwarmilmth
ffsillaqeqlekaldcqiygacysiepldlpqiierlhglsafslhsyspgeinrvasc
lrklgvpplrvwrhrarsvrarllsqggraatcgkylfnwavktklkltpipaasqldls
gwfvagysggdiyhs

SCOPe Domain Coordinates for d3udla_:

Click to download the PDB-style file with coordinates for d3udla_.
(The format of our PDB-style files is described here.)

Timeline for d3udla_: