Lineage for d3u8nd_ (3u8n D:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819477Family b.96.1.1: Nicotinic receptor ligand binding domain-like [63713] (2 proteins)
    automatically mapped to Pfam PF02931
  6. 2819576Protein automated matches [190922] (2 species)
    not a true protein
  7. 2819577Species Great pond snail (Lymnaea stagnalis) [TaxId:6523] [190008] (38 PDB entries)
  8. 2819676Domain d3u8nd_: 3u8n D: [186175]
    automated match to d1uw6a_
    complexed with 09s, nag, so4

Details for d3u8nd_

PDB Entry: 3u8n (more details), 2.35 Å

PDB Description: crystal structure of the acetylcholine binding protein (achbp) from lymnaea stagnalis in complex with ns3950 (1-(6-bromo-5-ethoxypyridin- 3-yl)-1,4-diazepane)
PDB Compounds: (D:) acetylcholine-binding protein

SCOPe Domain Sequences for d3u8nd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u8nd_ b.96.1.1 (D:) automated matches {Great pond snail (Lymnaea stagnalis) [TaxId: 6523]}
ldradilynirqtsrpdviptqrdrpvavsvslkfinilevneitnevdvvfwqqttwsd
rtlawnsshspdqvsvpisslwvpdlaaynaiskpevltpqlarvvsdgevlympsirqr
fscdvsgvdtesgatcrikigswthhsreisvdpttensddseyfsqysrfeildvtqkk
nsvtysccpeayedvevslnfrkkg

SCOPe Domain Coordinates for d3u8nd_:

Click to download the PDB-style file with coordinates for d3u8nd_.
(The format of our PDB-style files is described here.)

Timeline for d3u8nd_: