SCOP 1.73: Domain d3ccpa_: 3ccp A:

Lineage for d3ccpa_ (3ccp A:)

1. Root: SCOP 1.73

2. Class a: All alpha proteins [46456] (258 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (112 PDB entries)

8. Domain d3ccpa_: 3ccp A: [18616]
   complexed with hem; mutant

Details for d3ccpa_

PDB Entry: 3ccp, 2.2 Å

PDB Description: x-ray structures of recombinant yeast cytochrome c peroxidase and three heme-cleft mutants prepared by site-directed mutagenesis

PDB Compounds: (A:) yeast cytochrome c peroxidase

SCOP Domain Sequences for d3ccpa_:

Sequence; same for both SEQRES and ATOM records:

>d3ccpa_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
tplvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhd
ntggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqg
pkipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkth
lknsgyegpfgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqd
pkylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d3ccpa_:

• d3ccpa_ first appeared (with stable ids) in SCOP 1.55, called d3ccp__
  
• d3ccpa_ was called d3ccp__ in SCOP 1.71
  
• d3ccpa_ appears in SCOP 1.75
  
• d3ccpa_ appears in the current release, SCOPe 2.08