SCOPe 2.06: Domain d1dcca_: 1dcc A:

Lineage for d1dcca_ (1dcc A:)

1. Root: SCOPe 2.06

2. Class a: All alpha proteins [46456] (289 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (4 families)

5. Family a.93.1.1: CCP-like [48114] (5 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (198 PDB entries)
   Uniprot P00431

8. Domain d1dcca_: 1dcc A: [18613]
   complexed with hem, oxy

Details for d1dcca_

PDB Entry: 1dcc, 2.2 Å

PDB Description: 2.2 angstrom structure of oxyperoxidase: a model for the enzyme:peroxide complex

PDB Compounds: (A:) cytochrome c peroxidase

SCOPe Domain Sequences for d1dcca_:

Sequence; same for both SEQRES and ATOM records:

>d1dcca_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae) [TaxId: 4932]}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpfgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d1dcca_:

• d1dcca_ first appeared (with stable ids) in SCOP 1.55, called d1dcc__
  
• d1dcca_ appears in SCOPe 2.05
  
• d1dcca_ appears in SCOPe 2.07
  
• d1dcca_ appears in the current release, SCOPe 2.08