Lineage for d3u81a_ (3u81 A:)

  1. Root: SCOPe 2.01
  2. 968085Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 999457Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily)
    core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest
  4. 999458Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (58 families) (S)
  5. 999459Family c.66.1.1: COMT-like [53336] (4 proteins)
  6. 999478Protein automated matches [190251] (3 species)
    not a true protein
  7. 999487Species Norway rat (Rattus norvegicus) [TaxId:10116] [187033] (18 PDB entries)
  8. 999488Domain d3u81a_: 3u81 A: [186107]
    automated match to d1h1da_
    complexed with k, sah

Details for d3u81a_

PDB Entry: 3u81 (more details), 1.13 Å

PDB Description: crystal structure of a sah-bound semi-holo form of rat catechol-o- methyltransferase
PDB Compounds: (A:) Catechol O-methyltransferase

SCOPe Domain Sequences for d3u81a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3u81a_ c.66.1.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
gdtkeqrilryvqqnakpgdpqsvleaidtyctqkewamnvgdakgqimdavireyspsl
vlelgaycgysavrmarllqpgarlltmeinpdcaaitqqmlnfaglqdkvtilngasqd
lipqlkkkydvdtldmvfldhwkdrylpdtlllekcgllrkgtvlladnvivpgtpdfla
yvrgsssfecthyssyleymkvvdglekaiyqgpsspd

SCOPe Domain Coordinates for d3u81a_:

Click to download the PDB-style file with coordinates for d3u81a_.
(The format of our PDB-style files is described here.)

Timeline for d3u81a_: