Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
Superfamily c.23.13: Type II 3-dehydroquinate dehydratase [52304] (2 families) |
Family c.23.13.0: automated matches [191662] (1 protein) not a true family |
Protein automated matches [191250] (6 species) not a true protein |
Species Bifidobacterium longum [TaxId:759350] [189776] (1 PDB entry) |
Domain d3u80b_: 3u80 B: [186106] automated match to d1h05a_ |
PDB Entry: 3u80 (more details), 1.6 Å
SCOPe Domain Sequences for d3u80b_:
Sequence, based on SEQRES records: (download)
>d3u80b_ c.23.13.0 (B:) automated matches {Bifidobacterium longum [TaxId: 759350]} mtkvivvngpnlgrlgvrqpdvygrqdldtlrklcaewgkdlglevevrqtddeaemvrw mhqaadektpvvmnpaafthysyaladaahmvidenlplmevhisnpsardefrkrsvis pvatgtitgmgfygyklaldavahllse
>d3u80b_ c.23.13.0 (B:) automated matches {Bifidobacterium longum [TaxId: 759350]} mtkvivvngpnqdldtlrklcaewgkdlglevevrqtddeaemvrwmhqaadektpvvmn paafthysyaladaahmvidenlplmevhisnpsarvatgtitgmgfygyklaldavahl lse
Timeline for d3u80b_: