SCOP 1.69: Domain d1ccl__: 1ccl -

Lineage for d1ccl__ (1ccl -)

1. Root: SCOP 1.69

2. Class a: All alpha proteins [46456] (218 folds)

3. Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily)
   multihelical; consists of two all-alpha domains

4. Superfamily a.93.1: Heme-dependent peroxidases [48113] (3 families)

5. Family a.93.1.1: CCP-like [48114] (4 proteins)

6. Protein Cytochrome c peroxidase, CCP [48119] (1 species)

7. Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (85 PDB entries)

8. Domain d1ccl__: 1ccl - [18608]

Details for d1ccl__

PDB Entry: 1ccl, 2 Å

PDB Description: probing the strength and character of an asp-his-x hydrogen bond by introducing buried charges

SCOP Domain Sequences for d1ccl__:

Sequence; same for both SEQRES and ATOM records:

>d1ccl__ a.93.1.1 (-) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeydnyigygpvlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnekylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl

Timeline for d1ccl__:

• d1ccl__ first appeared (with stable ids) in SCOP 1.55
  
• d1ccl__ appears in SCOP 1.67
  
• d1ccl__ appears in SCOP 1.71
  
• d1ccl__ appears in the current release, SCOPe 2.08, called d1ccla_