SCOPe 2.06: Domain d3u1je_: 3u1j E:

Lineage for d3u1je_ (3u1j E:)

1. Root: SCOPe 2.06

2. Class g: Small proteins [56992] (94 folds)

3. Fold g.8: BPTI-like [57361] (1 superfamily)
   disulfide-rich alpha+beta fold

4. Superfamily g.8.1: BPTI-like [57362] (4 families)

5. Family g.8.1.1: Small Kunitz-type inhibitors & BPTI-like toxins [57363] (13 proteins)

6. Protein Pancreatic trypsin inhibitor, BPTI [57364] (1 species)

7. Species Cow (Bos taurus) [TaxId:9913] [57365] (86 PDB entries)

8. Domain d3u1je_: 3u1j E: [186058]
   Other proteins in same PDB: d3u1jb_
   automated match to d1bpia_

Details for d3u1je_

PDB Entry: 3u1j, 1.8 Å

PDB Description: Aprotinin bound to Dengue virus protease

PDB Compounds: (E:) pancreatic trypsin inhibitor

SCOPe Domain Sequences for d3u1je_:

Sequence; same for both SEQRES and ATOM records:

>d3u1je_ g.8.1.1 (E:) Pancreatic trypsin inhibitor, BPTI {Cow (Bos taurus) [TaxId: 9913]}
rpdfcleppytgpckariiryfynakaglcqtfvyggcrakrnnfksaedcmrtcg

Timeline for d3u1je_:

• d3u1je_ first appeared in SCOPe 2.01
  
• d3u1je_ appears in SCOPe 2.05
  
• d3u1je_ appears in SCOPe 2.07
  
• d3u1je_ appears in the current release, SCOPe 2.08