SCOPe 2.04: Domain d3u0za_: 3u0z A:

Lineage for d3u0za_ (3u0z A:)

1. Root: SCOPe 2.04

2. Class b: All beta proteins [48724] (176 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.2: cAMP-binding domain [51210] (13 proteins)
   Pfam PF00027

6. Protein automated matches [190352] (8 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [187178] (3 PDB entries)

8. Domain d3u0za_: 3u0z A: [186050]
   automated match to d1q5oa_
   complexed with cmp

Details for d3u0za_

PDB Entry: 3u0z, 2.9 Å

PDB Description: Tetramerization dynamics of the C-terminus underlies isoform-specific cAMP-gating in HCN channels

PDB Compounds: (A:) Potassium/sodium hyperpolarization-activated cyclic nucleotide-gated channel 1

SCOPe Domain Sequences for d3u0za_:

Sequence; same for both SEQRES and ATOM records:

>d3u0za_ b.82.3.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
dssrrqyqekykqveqymsfhklpadmrqkihdyyehryqgkifdeenilselndplree
ivnfncrklvatmplfanadpnfvtamlsklrfevfqpgdyiiregavgkkmyfiqhgva
gvitksskemkltdgsyfgeiclltkgrrtasvradtycrlyslsvdnfnevleeypmmr
rafetvaidrldrigkkns

Timeline for d3u0za_:

• d3u0za_ first appeared in SCOPe 2.01
  
• d3u0za_ appears in SCOPe 2.03
  
• d3u0za_ appears in SCOPe 2.05
  
• d3u0za_ appears in the current release, SCOPe 2.08