Class b: All beta proteins [48724] (176 folds) |
Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies) one turn of helix is made by two pairs of antiparallel strands linked with short turns has appearance of a sandwich of distinct architecture and jelly-roll topology |
Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families) |
Family b.82.3.2: cAMP-binding domain [51210] (13 proteins) Pfam PF00027 |
Protein automated matches [190352] (8 species) not a true protein |
Species Mouse (Mus musculus) [TaxId:10090] [187178] (3 PDB entries) |
Domain d3u0za_: 3u0z A: [186050] automated match to d1q5oa_ complexed with cmp |
PDB Entry: 3u0z (more details), 2.9 Å
SCOPe Domain Sequences for d3u0za_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3u0za_ b.82.3.2 (A:) automated matches {Mouse (Mus musculus) [TaxId: 10090]} dssrrqyqekykqveqymsfhklpadmrqkihdyyehryqgkifdeenilselndplree ivnfncrklvatmplfanadpnfvtamlsklrfevfqpgdyiiregavgkkmyfiqhgva gvitksskemkltdgsyfgeiclltkgrrtasvradtycrlyslsvdnfnevleeypmmr rafetvaidrldrigkkns
Timeline for d3u0za_: