Lineage for d1bvaa_ (1bva A:)
- Root: SCOP 1.55
Class a: All alpha proteins [46456] (138 folds) 
Fold a.93: Heme-dependent peroxidases [48112] (1 superfamily) Superfamily a.93.1: Heme-dependent peroxidases [48113] (2 families) 
Family a.93.1.1: Cytochrome c peroxidase-like [48114] (6 proteins) 
Protein Cytochrome c peroxidase, CCP [48119] (1 species) Species Baker's yeast (Saccharomyces cerevisiae) [TaxId:4932] [48120] (64 PDB entries) 
Domain d1bvaa_: 1bva A: [18604]
Details for d1bvaa_
PDB Entry: 1bva (more details), 1.89 Å
PDB Description: manganese binding mutant in cytochrome c peroxidase
SCOP Domain Sequences for d1bvaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bvaa_ a.93.1.1 (A:) Cytochrome c peroxidase, CCP {Baker's yeast (Saccharomyces cerevisiae)}
lvhvasvekgrsyedfqkvynaialklreddeyenyigygddlvrlawhisgtwdkhdnt
ggsyggtyrfkkefndpsnaglqngfkflepihkefpwissgdlfslggvtavqemqgpk
ipwrcgrvdtpedttpdngrlpdadkdagyvrtffqrlnmndrevvalmgahalgkthlk
nsgyegpwgaannvftnefylnllnedwklekndanneqwdsksgymmlptdysliqdpk
ylsivkeyandqdkffkdfskafekllengitfpkdapspfifktleeqgl
SCOP Domain Coordinates for d1bvaa_:
Click to download the PDB-style file with coordinates for d1bvaa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bvaa_:
- d1bvaa_ appears in SCOP 1.57
- d1bvaa_ appears in the current release, SCOPe 2.08
View in 3D