Lineage for d3tzqd_ (3tzq D:)

  1. Root: SCOPe 2.04
  2. 1565955Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 1576363Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 1576364Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 1580116Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 1580117Protein automated matches [190069] (181 species)
    not a true protein
  7. 1581053Species Mycobacterium marinum [TaxId:216594] [189743] (2 PDB entries)
  8. 1581059Domain d3tzqd_: 3tzq D: [186035]
    automated match to d2ew8a1
    complexed with edo, gol, peg

Details for d3tzqd_

PDB Entry: 3tzq (more details), 2.5 Å

PDB Description: crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum
PDB Compounds: (D:) Short-chain type dehydrogenase/reductase

SCOPe Domain Sequences for d3tzqd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3tzqd_ c.2.1.0 (D:) automated matches {Mycobacterium marinum [TaxId: 216594]}
aelenkvaiitgacggigletsrvlaragarvvladlpetdlagaaasvgrgavhhvvdl
tnevsvralidftidtfgrldivdnnaahsdpadmlvtqmtvdvwddtftvnargtmlmc
kyaiprlisagggaivnissatahaaydmstayactkaaietltryvatqygrhgvrcna
iapglvrtprlevglpqpivdifathhlagrigepheiaelvcflasdraafitgqviaa
dsgllahlpglpqirasva

SCOPe Domain Coordinates for d3tzqd_:

Click to download the PDB-style file with coordinates for d3tzqd_.
(The format of our PDB-style files is described here.)

Timeline for d3tzqd_: