![]() | Class d: Alpha and beta proteins (a+b) [53931] (385 folds) |
![]() | Fold d.153: Ntn hydrolase-like [56234] (2 superfamilies) 4 layers: alpha/beta/beta/alpha; has an unusual sheet-to-sheet packing |
![]() | Superfamily d.153.1: N-terminal nucleophile aminohydrolases (Ntn hydrolases) [56235] (8 families) ![]() N-terminal residue provides two catalytic groups, nucleophile and proton donor |
![]() | Family d.153.1.4: Proteasome subunits [56251] (4 proteins) |
![]() | Protein automated matches [190144] (11 species) not a true protein |
![]() | Species Bacillus anthracis [TaxId:198094] [189742] (1 PDB entry) |
![]() | Domain d3ty6d_: 3ty6 D: [186010] automated match to d1yyfc1 complexed with so4 |
PDB Entry: 3ty6 (more details), 2.5 Å
SCOPe Domain Sequences for d3ty6d_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3ty6d_ d.153.1.4 (D:) automated matches {Bacillus anthracis [TaxId: 198094]} nfhattifavhhngecamagdgqvtmgnavvmkhtarkvrklfqgkvlagfagsvadaft lfemfegkleeyngnlqraavemakqwrgdkmlrqleamlivmdkttmllvsgtgeviep ddgilaigsggnyalsagralkqyasehltakqiakasleiagdicvytnhniiveel
Timeline for d3ty6d_: